SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|159671 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|159671
Domain Number 1 Region: 2611-2807
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-21
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 2 Region: 1393-1412,2009-2187
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.64e-20
Family Laminin G-like module 0.0076
Further Details:      
 
Domain Number 3 Region: 2200-2361
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-19
Family Laminin G-like module 0.006
Further Details:      
 
Domain Number 4 Region: 2393-2561
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000146
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 5 Region: 1122-1173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 6 Region: 1273-1324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 7 Region: 717-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 8 Region: 813-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000558
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 9 Region: 99-197
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000279
Family Galactose-binding domain 0.084
Further Details:      
 
Domain Number 10 Region: 490-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 11 Region: 284-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000209
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 12 Region: 861-908
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.023
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|159671
Domain Number - Region: 336-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family Laminin-type module 0.042
Further Details:      
 
Domain Number - Region: 1078-1124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000181
Family Laminin-type module 0.06
Further Details:      
 
Domain Number - Region: 766-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family Laminin-type module 0.021
Further Details:      
 
Domain Number - Region: 1322-1367
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number - Region: 413-451
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000781
Family Laminin-type module 0.018
Further Details:      
 
Domain Number - Region: 449-487
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000837
Family Laminin-type module 0.016
Further Details:      
 
Domain Number - Region: 1227-1275
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00237
Family Laminin-type module 0.03
Further Details:      
 
Domain Number - Region: 1180-1229
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family Laminin-type module 0.034
Further Details:      
 
Domain Number - Region: 2822-2889
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00396
Family Laminin G-like module 0.05
Further Details:      
 
Domain Number - Region: 1669-1748
Classification Level Classification E-value
Superfamily EsxAB dimer-like 0.0615
Family ESAT-6 like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|159671
Sequence length 2898
Sequence
MYIQQSSSSSSSSSFFSFSTSSSSSSSSLHHRHHHKTILNINIILSCIILLVTIFHSNAL
DPVVNVARGKPTTAQLTCGFAGPERFISHKYTGVQTSQNVETCYNVSSYPSSNMVDGNDG
TWWQSTSRINFIGQGYGVNGKPDAFIELDLKQMFEVQSMSLLFGDSQRPGRMAFYKTTDA
NTIYQNWFYVVSSSLDCKTYFNVPVLLQANGIQSTPCMLYTAPPSISQKVEYTFTNLVPQ
AKPWVNVRKIKVEFYQIDLTLGVTAGSNDFQHYTVRSLDVFAKCPCNGQLTDCLLDNTTN
EQTCVCGGFTAGKFCEVCQPLYNNKLYAYGTPCEMCNCNNLATSCHFDAVLNTGVCDNCQ
NFSAGPKCDSCVDNFYKSLTDGRCIPCSCAGDYVKPGGGCYKTASDVIPAGNPNPQPGDC
YCMPYIIGPKCDRCQDGAYGLSASGCTDCACLVNGTIGASILCDSAGQCACKTNVMGARC
DTCKDGCTACGCDIGGSTSTTCDKTSGQCTCEIGVTGRLCDGPAAGFYYPNLQFLSAELE
SLDAPWDKTTSGYSGFGYVVPISQIPVSANIDLTSLVSSDLNTFKLMLRCMASAPVNGVL
GVGQNNVISTTLNMAIPLTSSWQYVPIGDVTLTKGTVSKITITIPTIVPGTAINLDRIVA
IPAEYFNATFLLGQPADASFQSTCMPPANADLGTSNANCLKPLFTLSTFKLNGALPCNCD
FTGSTNLTYCEPAGGKCPCKPGVTGRRCDQCDVNFSNLGMAGCLACNCTATTYNMCDPRS
GSCLCPPGSQGDRCQTCMLNYYSWNELKGCQPCSCNTIGSTSLSCNVSSGSCSCKYGVTG
LKCDQCQDGFWQLTSAGCSPCNCDPGGAVSPTCDKGTGACTCKSNVQGRQCTECKINSFS
MFPSLADGCLTCICMGITTICSASYYIPTTIDLTPDLSTIIAVSSSGDPSPAIISVVGDM
ANMAVPQQSPNIYCISCIAMYSATTLTTPPVQPLQVIVISNKGSQMTFKTLNSNPTIPLP
NVPYQMTTNLTVENLVSPTVGVTRASVLLLLNDVKAVLLPAVFASVAHQSSVGSLTYQMQ
PNLVEKCSCPPGYEGSSCEKCSLGYFRDALTTSDYLGKCIPCQCSAMSNTCDEVTGVCSN
CQQNTAGSNCELCQPGFYRNPPSSSGPCLKCPCEGPRVNSTNCEVRNGSVVICTSCSFGY
EGDICNKCRADHYGNLATNLMNVCKPCACNGLSTTCDEFGNCLNCTSFTTGSSCEKCVDG
KYKDSVTSACVDCNCSYTGSSSNLTCDGVTGQCRCKHGVGWRACDQCLPNYFNFTSNGCL
PCECNTLGSASSQCISNGSCLCNPDTEGFKCDVCSVGAFGILNGLPCQKCACDPRGTVNT
TQDLATCDRLTGQCNCRPNVVGRNCSMCAPMYSTVPEVLDCQKCDVCSTSLGNDVIAMVN
TATSGISSHLTELAQFQQLNQQLISSQLTLSNYCLQLNSCIDASNSYYFFKNGLHIQLNV
TAVTRANKIIELNNTANALNLRAGQLNNDTLAELSRMTALKTESDVMGVASNKLNSDLDS
HVNKFQTYNMTAANSNQVSSLLLRSNDLTKRANEILAVLLTMETTTNSIKSNILGSRQIS
LSTDTNILSLNQTVRMVDSQLVSFQNDIISLIGLRTQSNDLYKSYSDIVQSTETLLGITR
TNLTNCMLTFTECLNLMHGTWTNQPQISIDSGFQSWSLAYQTVNLILTTVNSSLNNPQSK
LLNAEQRADALATQANTISGSFDQVKSKGQPQVDAINKFQSVIVSLQSALDSTKSMNDTL
QDVLRYLNAAPITDLQNRVNISTAMANQEKSQIDNLTSSYSDAALNKALDDAATSFQNSV
NMWNGLDTPLNNFSSSYTDLMTFILSISPSLNNNYQTGMNRVQEDNASLSALDTANNALR
SNVDALNNSINSISIDVTNAYVEESSLKANLTAFKAKLDQVRTLTINSTRTSLDSVNASR
PALDARFNNVSNLFKQLQDKLANLEQPVFFQPNTYEQVNNPDINVNDLYNSLGLDFMFPK
QKRGVLLFVENTLSNEKLLVQILNGSVCFEYSSAGSRTIVCNYAQLTAGAWYRVYATRYE
LDIKLTVILLSTGGSVTVSNTSTSSNNLGMVLNSPIYVGGLPLNAANIQKVYDSGIGFNG
CIYRVLYNGVTMPIWQSTFRKDSTASCCKKPPQEPQASTITSCVTAYGSGYIAYNPAAPG
AFTASSGASLSIQFRTFSPNGVLFLVSSMSTGDFLGVFLQNGKVVFHVSSQMALYSALTD
STYNNGNWYKFTATYSPSSMTLLVERVNASTAQPSETKTATLFNANLLTLNGAIYMVGGQ
NGTYIRGPVSKSFSGSLMNFQHTTASSGALVPHVWSADVLSSSDVDMNTCLDQVQSGLGF
STPSSYCVIAPGLVPIGTMDISFITSSLSGILLFAPLEQTATSSNTFLYIALFNGDIFIF
FDQGQGRQPVFRTRSLMLADNVMHKLSLDFRFVNSPRMKVDNSEAYVGALNMNSNMKLKM
NLIYIGGIPPSVWMDNSYLPIRQSFVGGLKEITINPNNAPSYQPVLIKFDDPTYLKLDQC
KSVYLGGIQNPLTPVSPPCNPCPSSETTQKCLTPTSVTNNSATNSATTSGYSFGDVSESY
VAYSVVGEENVFVQGLVVQLTFKALQPDGLLLYLANQPTSPLTDYFAIYLSKGFVNVVLM
NANSLKTVASKKSYYDGEWHSVTTVRVNNFLAILLEDSGDYNNNNVDINSSSSAVSNLFI
SSPLYAGGLPLSLTSYPTTIPIGKTNFKGCIGNLVVQSYNYKTITFTESKELIKVGVSNC
LSGAQLGMYLSTANSYVQVSDSYNANPVYSLVPGFSLILTFKTIATSGVLAVAWDSPNKF
VSLSLINGESVAIRAIIT
Download sequence
Identical sequences T1EPA7
XP_009009792.1.102002 jgi|Helro1|159671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]