SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|159828 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|159828
Domain Number 1 Region: 159-218,281-416
Classification Level Classification E-value
Superfamily vWA-like 3.12e-29
Family Integrin A (or I) domain 0.0029
Further Details:      
 
Domain Number 2 Region: 580-630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000375
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 621-684
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000612
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|159828
Domain Number - Region: 492-522
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0283
Family TNF receptor-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|159828
Sequence length 1154
Sequence
MHNSNNKNSEICCRLPRNNNSCNNFIKPKINIRFLSALTSDNKSLYINNNNNNIKNNINN
NDNKINNNNSNSNKIKNNNNIIGKTTHANHTKNTNINHLNDNINNFLRNNISKQKRSSSN
EPTTTTTATTTTPSTTTTTPFEINHNSHNNNINIVDATFAKRPKKEIDIIFMLDSSASVA
KDGWIKSIQFVKSLLGYMTVGEDSAQVSVISFNNDPTILINGFKRDNNTNNNNSNNNNNN
NDDDGDDYEDLDIILDESNKHQQHQQHQQQHRHRVNFSYINTPHNNNNNNNKCTLYEQLD
YHSDYKNFNTSGYTNTHKALFSAFSLLNQTRTHSKKILVLISDGNSNLGEAPAKFAEEMI
LSFTRDDKWDKKSFGPKLEIFAFGIGKNSNFEELNSIALNVDSTEQHVYSIENFVDSSNN
DNDVIYNNNNNNNDDDDTINNSVEDINDMIFNDDTYYDKNINNNNNNKNNNNNNNNNNKI
CTCSARRGRYVFSCPPGYEMADAICTECKLGYYSNVASPAPCQPCPEELTTNQRGSTVCD
KRRPGYFSCPDLDPIPNAIGHLVPGLVRDESYLVSSISGNCANVTNGNTCHFRCRKGFRL
FGSPYLICDDDGSWKGDVPICARITCPRTLPMNPNYDVTLLNNSYTYLSMVELKCKHGFF
PLGPTTYQCDEYGVWRHVHKFYCVDASSITCPRAKLDRYAQFDSDACYQERVPIDTEPPR
INCRDDVILELYPGEYVAHYVANLSLVSMSDNSGIYKGAIHGAPENSFYHLGEHFLVFVV
TDDVGLSSQCVKKIIVRARKTDITCPSNQTVYKPMNMDSIQVNWEFPQDNDPNIKVECNL
ESGSSFQDGTFHVSCLADELQHCDFFVNVIDLIPNCSFPLENILPTNGYLDCLKVNSAEN
FYKYCFIRCPKHHKLFGTKWTRGPYTELKMAVFKCTYDNQWFDGSGGLIGGETKDVKYEC
REYQQHQQQQQQHQQTKAFGLCSQQQDVKKLKPTLNDKSVLDYEQDVNASIVTISEYSIP
ISSNFETLGGRTKLNIPFIFTKIGKIKSEYRNNNNNNLYKYNINNEHGTNSNSNPSINNN
NIIVPSNNNDNHQSKENFTMEIGDLDESVVSYRGGSSGEHVLIMQISLMVISFLSSSSLF
VVVVRWLLRGKKQK
Download sequence
Identical sequences T1EPG1
XP_009009915.1.102002 jgi|Helro1|159828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]