SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|160242 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|160242
Domain Number 1 Region: 121-141,187-301
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000174
Family Laminin G-like module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|160242
Sequence length 648
Sequence
MIYISEGLKNEEPLVDNEGSSIEESIIRSKGTEPTSFAMMINMGDVVGRGGKLNGISFVG
CMGLLSAILSGDPQLQVPKQKIELQLHSSAGVTDGCVDGCQTMRKLCYNGGVCVNMYTHL
HCDCGLTHYVGEFCQHLESGFDNDFELSSLSKNHEAVTLKGDRFLLVNVEGFEHQLYNLQ
QSMLSFFFKGCELSASTNLRQKKTREYFCTFNTCASGSPTSDYNAELLGYVSKKDGSRLR
LSLFNASIHLSLIYDNKKFYNELILTAASNLNDNRWHRVTMTTSMSGELINISVDGHVER
MPLGAGEEGEDEVEEEDDDDGGENDDGGDVESEGDDGGGGDDDDVDYKKMRHHVLQWPKF
IYFGNTESGSRSASSVSLKTIYINGLSVLNSNQKKFCSFQPTSQASSTTTSSSELRSRQF
QTGTSSTFKPSQSLLGDAKLKKSILTNIFLDDVDNINLRNSSKSSRMMKLVTSRVNHTAS
QTNSPTKAQLGEQTFHENVSSTNGANETPLRSKIRTPSEQTHLNQNLMSDDPSWIGDINS
MNGEPDDDHYKHYVAEDFGESIEIKCHKPNNTADNNNNNSHNNNNNNTDHETKNSSKERK
ENVFQKESNEDEYGAVVEMLMADSELVCRQHKCAPGGRDDGEHVNISG
Download sequence
Identical sequences T1EQ07
jgi|Helro1|160242 XP_009015474.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]