SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|160283 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|160283
Domain Number - Region: 220-255,292-340
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000419
Family Spermadhesin, CUB domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|160283
Sequence length 413
Sequence
MHQPLVNARSSLLLLLFLFYIFCNNNIMFQTNTVGKHVKNGTFLPNKNIKKYKNFGNSSY
DGSYINVILNNIGYIREEITFHAERTTAKKYSYKGPNNLCNSNYQNNNIIDNNINNNIII
NNNRITSSYVNYSNKNNLYKRINYNSNKNNCIISTNIFNHLLIYDNVFVVAHFNKTAPLQ
LQKNDLHKKQKRHKNKRSHNNIFNNYNYYYNGNSNYYSSNKNVRSLNCPWKIKASTGQQI
TLKIIFMEQTVVSDHTINQTTTTTTNNNNNVNNIDGLTSITTNHNNYNLWTSYRPKRCGS
YLYVRDVGINFRKISLCGDETTRERPLLTSSSNELLMYLQDNDEDDDADEVNNVGHRESS
KDDDSDDGDDDDFDRDDVIVVQKVLISYEAPAAFKNSHKVADHEEWPSNLPDA
Download sequence
Identical sequences T1EQ18
XP_009015505.1.102002 jgi|Helro1|160283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]