SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|160750 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|160750
Domain Number - Region: 98-167
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0087
Family Glycosyl hydrolases family 32 C-terminal domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|160750
Sequence length 202
Sequence
MAYKLAPLLKEPVLFQISAMLSSFYFVALIFSMMPDAGVRAKCFEVFEMESRSYCTCAEP
FKSTMISAVASYRQALLLCSMRCSQLGNCMAFNFWDSSNFCQLFNQTTKSLSMISNCKHY
LNAEVHESRLSYNKTLNITVDNELIEFYVNGVSVPTRLYFPNADDWSKADTYNIQGYIHV
LAIKSLNSGGTENITGTESDAG
Download sequence
Identical sequences T1EQP0
jgi|Helro1|160750 XP_009015936.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]