SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|160848 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|160848
Domain Number 1 Region: 132-233,270-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000336
Family Laminin G-like module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|160848
Sequence length 384
Sequence
MESKRRRKKLESEKRGSEKNKNQQAVLHQNKAENAKIDKRPTEMKTDSRYVNNRPKRNTI
TTDTQLIPTNTNTHGIPTSGYTPGKDANKDNRYNEGGTKNVPGDNHGVKFLKSFVVNNAV
TIKSCKYMLAVKQKIYGVFHVALKFRTTFPSVVLMTSVGGPLNRDFLHLELLNGHVRYSY
DVGSGPRVRVFRRNLTTHWLIVDDVIRLHDNLPAIKSVYYDLANDWLFFGGAPNSGPIRN
GDGLKYQNNFYSSGKNYKYANYYNEGAGCGGRGFLGCLGDISVNGASMRKVQKEKKIVFA
TKKKMIRMIENDDDDDDGVKDDDDDGGDGGKGISDYDGNDDEDDDEDNVEDEEEDDDEEE
EEIAEGCQETSELRLLDFKEMKLN
Download sequence
Identical sequences T1EQT6
XP_009016026.1.102002 jgi|Helro1|160848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]