SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161175 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161175
Domain Number 1 Region: 26-118,175-441,528-586,616-644
Classification Level Classification E-value
Superfamily MFS general substrate transporter 6.8e-24
Family LacY-like proton/sugar symporter 0.066
Further Details:      
 
Domain Number 2 Region: 450-502
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000291
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161175
Sequence length 662
Sequence
MDCNKNEDSTPQSLSVGERIVQLFNGLRKNIWTFIVLYFIFSFSHGVQGTYTSTILATLE
NNFNLPSSLSSIIIIVATLGYMSSAITVSFILTSKHHVRLFAVCMLVTGFCGLLYMLTHF
IFKDSSNINEIAATTDLEKPDRNYVSAVCNASRNINESSESLCTGSNNNKRDIGPNYVAL
GMFVISEVFHGAAGACLWTVGLSFLDDNMPSNVAPKLIGIMYSVRFLSPVISSALGSVFL
SLHTSLTKTSLTPSHPKWIGAWWLGFVICFLINTIISLPTFFLPQTFENSKKLEHHTKGS
EQNLDDKFSSAKTASKVYHGKNLENFGLALGRLLRNPIYMLTTLGICFDCFIIPFYNYLP
KYVEVHFKLTAWMASIIAVMVPSIAGGIFSSVGGFVIGKFKPSPDFRVTKNMAFSCVISF
GSVLVLTAILFLQCPNVNSPSGYSEMTKSVSLTQTCNMNCSCLSDSFDPVCGDDNMWYAS
PCHAGCSSYATNGSMMYSDCSCINSVQQTAGRGYCDNSCFPILILYTIGWICFCSFSNLI
NVPLTNVTLKSVDEEDKSLALGLQLIIICVSVFPFTLIFGHMIDWTCILWKTTSCSDAVG
SCLAYDHSKFRFIMHGSVVCVRIIACVFYILSFIFARRKLSRLQLEELKNLDIMNITPHT
EK
Download sequence
Identical sequences T1ER69
XP_009019373.1.102002 jgi|Helro1|161175

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]