SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161301 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161301
Domain Number 1 Region: 17-147
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000196
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161301
Sequence length 164
Sequence
MNNLFVQPDISFDTDACNQSYSGRITNGVIKSFNYPFDYINNLSCTYKFYFSDAQYTTSK
KICFKTRRFDLERSIAYCTFDYLQIEDNKYCGRGLWQKGLYDPKQPTSSLWVNNLCWSLN
YVETFELKFVSDSSVVGAGFYFEYSIINNTTDFSHQYPDSKIDK
Download sequence
Identical sequences T1ERB4
jgi|Helro1|161301 XP_009019482.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]