SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161317 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161317
Domain Number 1 Region: 146-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000277
Family Ovomucoid domain III-like 0.0068
Further Details:      
 
Domain Number 2 Region: 19-130
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.000000392
Family LacY-like proton/sugar symporter 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161317
Sequence length 292
Sequence
MTEKSTDTAKKLYRDKNMKNFFVALRRLARNPIFVLTSLGVCFDCYILAFYAYLPKYIEV
HFQLTAWMASLLGVMIPSIAGGIVSYVGGVISGKLKPTLDSGVTRNMIFVLTASLINVFV
LIAIMFLQCPSNSFPHGFSKSTSVGFQQTCNENCSCPLNSFDPVCGSDNVWYISPCHAGC
TSYANNGSSIYRDCSCVSNEPQTAKIGYCDSSCTLILSLYSIGLVCFFAINIIYNVPVTN
VVLNTILAMFNSALHGILRSAMNFVSDEEVVGGGKELLRKGPKKPKADLACV
Download sequence
Identical sequences T1ERB9
jgi|Helro1|161317 XP_009019494.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]