SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161326 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161326
Domain Number 1 Region: 16-112,150-340,375-426
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.14e-16
Family LacY-like proton/sugar symporter 0.027
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|161326
Domain Number - Region: 457-491
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000527
Family Ovomucoid domain III-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161326
Sequence length 683
Sequence
MPNNPGKKSLISYINKVRTNIWAFFILILLFAFTHGVQGSMITGVLTTVEKRFNLPSSLS
GILIAVATLGYISGVLINSIFLVNKSHVRVFAVFMTMTALAALIYVVPHFLFYNDMEPQK
VGPTANKQKFPNYTNKTNVGRTNKVALSMFCVAEIIQGVSGSSVWTIGLTFIDKNTSIAL
GSKLFGAIFLLRCFSPVLSFALGSSFLTFPVDLQSTSWSPEHPRWIGAWWLGYVVCFIAN
TLIAIPTYFLPDTFINAITSEERSKSQKSSLISKISETFNDYIDKPVKEKMSSVKRIVCN
PMYTIFSLGVCFDCYILAYFTFLPKYIEVNFRLSATTAPTFGVFAILHKLSTICLCTRCL
CKPSGATIVSEFVERGMIPVLCAGLSSYLGGVCSGKFEQSHDKGVSRNMTFVCAIAIVNL
FVLASLMNLRCSDEFYSATWSIEKQDENDLQTEMQRDDCNCRPNSFDPVCGPNKSLHIDK
CYVECVDWHKDSNKSRPCFLEDDLRTEGYCAFSCTTILGFLVFGIVIMSFLNSIYTVAIT
NVVLKSVSKKDKPLALVVPTPVLYGKLIDWTCILWIKSCDGTYGSCLVYDNNKFRYVLHG
NTLVWKILAVCSYIVAFTLAKKRLKKLESTPEEKEEKIVQELFRKVTAFPECVYGFCGRV
VSVSIYYSHDPSSNPAASAGSSE
Download sequence
Identical sequences T1ERC5
jgi|Helro1|161326 XP_009019503.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]