SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161493 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161493
Domain Number 1 Region: 2-121
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000471
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|161493
Domain Number - Region: 221-264
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00497
Family Spermadhesin, CUB domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161493
Sequence length 278
Sequence
MDGSDGTFRTPNYPSPYPPNISCILFTFIGDLHELVRIQFQRFELSPPAAIQNGCTDRIR
LFLDLERPEIPYDVNPNFEICGRMPANETTYFSSKRVMIVEFQSGTRLPYTFAGFQAFYT
FDKQSEFGVGSKRLNSECTYSFYSGNIKAKKFKISYPATSATETSTPDTSDTISSSPSFS
SSLKSSSSYSPSASHSSFLSTPTQSSLLSSPVSSSSSSHTSSSSSSSSSVYPSNAFVCQY
FFYGASNERVVINFTNVHLSSSSSVLVALRTLIICPLV
Download sequence
Identical sequences T1ERJ7
jgi|Helro1|161493 XP_009019656.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]