SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161503 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161503
Domain Number 1 Region: 175-218,270-330
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000955
Family Spermadhesin, CUB domain 0.0089
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|161503
Domain Number - Region: 414-478
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0497
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161503
Sequence length 719
Sequence
MTPAVSTSTVAGMVETFRYPQHIAPMRVHFLCSRRTLAFIIVLISTLCIQNSLQVEEKYC
YDESFRVACSRDDEVIVFRDATFGQMDGHHCIKGESGITKGCQKSVLHHLDRMCSGRKSC
NVLVNNVSFGSPPSCPKNYKPYLKIYYDCLRVVTAPANVSCASSGGRSVLINNQLHGYIA
SYVTMSTNLGSANCPWKIEVPKGLKINLTLIDFTMPTSDLWREYADVVGPGSGRYGNYDH
RGRYPLNLDPYHSHMYGGAGMSRGIGNDCKKYGIVSDKSSISRLAEKICGKDVREKHILF
SRSNAIELKIYTQDQMNQFWFLIKFDAIGCTEISPPQHGWMRKDENERWLMGCNHSDHTW
AMNCDDMENVWVGNYENCSAENYDSHYLVFGKVAVPYSSKEGDTSCDESLCRSHQPTPLK
VNPASISVTSSSQCATNNQPPLTQQPQEIKPKPILRNAQNYQQQQQQLQQQYNQSFVDAS
LLLSTIGSSSENVASCNIDENISKYSSRTLPSSMKGVKYSSHTPQSTLSTASNNNDYVRE
MWPMAPPIASKLTGIDRPDSRNGTSLFQYGDSVTFNLQSGQTSGGKTLQHHHHHHHLHHP
HPLHPQTQQLQQPLMHQQQPHQPQQTGTLIYDGDDDTHIYETPKYLRREKAATMRLQVKS
GQAKTLSFYEPTTNSTAPTNTNVITTVATASSMVTSSQDYRGSKTLPRQVLAVSASVKL
Download sequence
Identical sequences T1ERK3
XP_009019665.1.102002 jgi|Helro1|161503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]