SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161585 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|161585
Domain Number - Region: 166-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0553
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161585
Sequence length 206
Sequence
MVLIIIKDNDFSKRNNATNYKPNIHKEKISLTPKLLSISNPFKIKNNNSNNNNNIINNNN
NIINNNINNNNESNVYYDGDDDVDDHKNLPDYPDLWSLALSGARFVGNYESVIFNDEFVD
LSSLNGNNNNNINNIDFGSNINDINLDNNHYINSYYNNNFTIPYDKDCNMAFCLNGGKVV
GHFVGSGCMCNCLATNYHGNRCHLGL
Download sequence
Identical sequences T1ERN5
XP_009019738.1.102002 jgi|Helro1|161585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]