SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161586 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161586
Domain Number 1 Region: 162-221,264-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000006
Family Laminin G-like module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161586
Sequence length 479
Sequence
MPQTIHEDHVINRVTSPSSRAYVHVVYGAMGREGKENTPSPITFPGSGFITWNLKQTGNF
FLSNVEIISMYVKTPSAATSTTTTSGTSGSHIRNRNNSKNSNSDYSFDKNTISNSSSSSS
SSSSSSSSNSKSGSSSSSRKSEDNYNGDNRKQILYSATTLKLQVSYREVYLSDGGWHGVV
VERRVREVNVEIDGLVKKSGTIVVSELLGFSSDVITVGGIPKKRLQKAVRRDDDDDEDDD
DDEDDEDERYKKKSGGGYEGYLKDFKFFRGCLKQITLKFDNIHIDVFNQLQLNSHTYNKD
VSISRNIYNRHVSNNNNDNDNNIINNDKSFNNRSPSISSQRHKSLLKYSFHPIGQVTLNR
CDLANNKIPQFRFNRRSNNGLLNFFPLKHSPGGSLSSSFFFETASRHALLAVINFKSVCS
GTEDDDDDNGDNDDDNDDNDDEDGGEFMALELVDDEQLFVVCVGIIVNMDEVFKAETKA
Download sequence
Identical sequences T1ERN6
XP_009019739.1.102002 jgi|Helro1|161586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]