SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161680 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161680
Domain Number 1 Region: 46-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000011
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 2 Region: 7-45
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.01
Further Details:      
 
Domain Number 3 Region: 418-457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000311
Family EGF-type module 0.042
Further Details:      
 
Domain Number 4 Region: 233-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000561
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161680
Sequence length 470
Sequence
MPNREPPACLSRPCLNGANCTDLANGGYFCSCKPYYTGKNCETNIFHPCRSGPCVNGGKC
IELGNCTSQFKCVCPFGFTGARCEVEVKEFVLNVTARETLSALYLDSVQIFNLSNVADWK
KVATVRTPITTRLIAVMAGNIHDMCAGILLSERNQYILSSNINWKCYIDASLGWASLTYN
DSHWPTAHVVASNGPVVGCPDLEVVKDIHPDAKWIWTTRNIQFDLVVYCRGYIDICKSKP
CQNGGICHRSGSQLCACLKGFTGTFCEKVEYTDLSVFAYEKLESVYIDDVKMKTITNGVN
KYSLHPLVRQLKFMVIDANQVSDTKKCYGLVGSTGVGPIDLITYKLDWKSEYNTEAGWHR
NDFNDTKWVLPDELKMNNESRCTDLKPIPDIRSTARWIWPPKASDRYLVAFFRATTNLCK
KQLSICQNQGTCSPSKGPICVCPSTFTGPYCEYKIGVDVPGPEASCPSNF
Download sequence
Identical sequences T1ERS3
XP_009019822.1.102002 jgi|Helro1|161680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]