SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161907 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161907
Domain Number 1 Region: 139-181,244-315
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000249
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|161907
Domain Number - Region: 322-366
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00116
Family Complement control module/SCR domain 0.0063
Further Details:      
 
Domain Number - Region: 179-233
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00575
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161907
Sequence length 392
Sequence
MIAFTDIIKNYLVTVTIAIATTTIDLTETKEFCNMETFIANCSHIPNNLIVVEAASYGLM
RLGRCLKVDYSNKLGCRADVMAAMDRHCSGKVSCSVKLPDEQVYSLNVCPPEVTSYLDAS
YFCLNVEPENAQKCETATVLTSESGHISSLRSDLVRCRWFLKVPKGRRINITLIDFFHQP
NFQPYSHNYQIKHPQPQQPQQLQQPQQLLPTAISNINAQQQQQQQLHKHQPNHLSNYVTS
SECLKYAIVKETTTSDNSPPKISTICGGGPRVRTVYLSDTNSLEVSIYSALKGPFGTNGQ
IEKARFLLKYKAFGCPDLDPRGSDGWTVVREGEKSIISCNGSHDNASRYHLICEDDRWIG
DIPTCSARTADEAITNNDNNNNIYNINNKNTK
Download sequence
Identical sequences T1ES11
jgi|Helro1|161907 XP_009020027.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]