SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|161979 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|161979
Domain Number 1 Region: 48-288
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000222
Family YWTD domain 0.0031
Further Details:      
 
Domain Number 2 Region: 373-482,537-572
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000602
Family YWTD domain 0.0013
Further Details:      
 
Domain Number 3 Region: 804-986
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000693
Family YWTD domain 0.015
Further Details:      
 
Domain Number 4 Region: 662-698
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family EGF-type module 0.084
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|161979
Domain Number - Region: 302-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00012
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|161979
Sequence length 1063
Sequence
MPAANEQTPTILWSQKFGTWSKFRALIGQTDNWANQSALRYAHTQPKNKASYWSVDYNPR
NDVIYWSDESQPSFIYRQVSKNSFQWLDEDLDIYNLTRHRVYVNELAVDWMTGNIYFIDN
YNEVISLYKDPTVKVIHIDDVTHPIEMCLDSTNGFMFWLDTIANEGLYKIEKSNLLGGNR
SIINTSPISRRLSAITTYFSGRGDDGNDEVFIVWIEDVSRRVMFSDANGRDVREMYRFDE
NRIYRGIGAFQNNLFLADQSRLTVEMIDMKSGQLLNAIEIDALPTDLIVMHTLNKDIKHE
CDNKFCTDFCLNVGHLKGRCACRDGYYLALDGVSCEASRSIIIFATDDNLMLAIPNTNIP
HPYMFKLNLSISLTSLASIDETPFGMDTSFKDRRLFWTDTSTGSIFVISVNQNNSTRRSD
GGEGFATNWIDESVYWMDSRSGYLMTSEFDGSYHSIVHGGFKSGRGLVVDPYQGILYWSQ
LNRTTQKRQLCKLQFNNNNNIDNNNNSYNNNYNNNYNNNNNYYNHNYDVICFLTLKQETI
DDLVLVVRQQRLFWSDPSANKIWWVELKSGLVQSLDLKSNVNRFTIIEDIIVLTQTTPSS
SSSASSSPVKFVKIPSSSSLSSSSFVPEISGSLENRRLNMSNKSGAVTMFGNYLQPINDE
HTPCVTNDHKCDQLCVTITNGYTCRCAIGYIKTGNKCETDILQEPAIYFLDTFHKQIYQI
TVSSSSPPPSSSSSSSSLSSPLTSSLSLSSNNNNINNNINNNNINSNNNNSINNNSNINN
INNINNNNGDDGDDRGNIFNKLSTIHSFPHSSLIHPTQFQVDDIRGVIYILDLGQIKAFR
LADRKMELIDLTNTKEGSNMQISQIGLDIGANELFMTDVIAGKLMVLYLANRTVDVVMDK
LDHPFAVQVDSSNRMLYWTESGKLKRITLRSLATAGTTAAAEASSSSSKYDVTVWNCCSN
ITSIFLKDDVVYLADIEGHSIVLINTSISNNNSNNNNYNNDNNNNYNNNNNNSNNNNDNN
NNNNDNNNNNTSFGTFYFLNGTKFNSITSDGIYIYFAASNKRL
Download sequence
Identical sequences T1ES42
jgi|Helro1|161979 XP_009020095.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]