SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|162255 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|162255
Domain Number 1 Region: 749-775,1158-1267,1494-1545,1695-1716
Classification Level Classification E-value
Superfamily Sialidases 0.000000118
Family Sialidases (neuraminidases) 0.034
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|162255
Domain Number - Region: 864-889
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000858
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 1344-1369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0335
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|162255
Sequence length 1758
Sequence
MCLNDLHRYLLIICTLMQVVVIGTIQIDAAFFPCQINKLESSKKHDLNVILLFEGDVDFY
QPNHHYNASITLSEHIDSLKVIASYGNHHITDRDNDADADKHSSENENNINLCTSVLNVE
EPGKEKIKLFFSWKAPDDISDCVQFRRSTKGFQLSNDCDSTNYKSMTCQNNDEVEMVVYF
CHLKKNLSTYEKQIELETTFNINLPEELREPKNCVRWVSIPNETNYTGSCWGLDDVLIKS
STSFKNFLFDNFNDIDASNWLFFNQIKLKMLTERSFLHFENNASYIISNDLTLNKSPIGN
DDNLLSTGTELVMQVTVEVLLDANFIYDHTESVMSIEYSGDYGAHWNLLHEICFNSPACY
LTSHSFSVHLYDRNEIQNQQRHTILLSEALNNTSPVRFRWSVTNRRSGSTVLWNVLKVFY
KIPLIYFNVLTSVYVGHCREECWSRSGDCLPNLTCRSCEGGGVEKHCTSSPQPPLHEDFA
DAPFKLDDEEEIGHLFSYHTGASSSYSCGVLSSGRSMVFNEAGLRMGVMRMFNTTGVKFL
RFSLKVCDFYEDEFDDAVNNKSYIHVVAAFVLVEISCDSGVKWKTLKNISLSTGEFIKEK
TFTINIEPRRNNPPNDATFEAILTNEKNKLESDSSVYSRNICNTRIWQPADAQLNNQVWA
LDDVVYATFMHDALLERFHSPDPELAGKGKMIFDKASVGNYCQRNNVYRFQYLSSLETNA
LHVNSGHIIQFKLAYGCSRITHLISTPSALSVFVVKFSVDNGKTWNILEKGCVAMGDCDN
NYKQGSIFHPVEFYYGWKNLVIVIPKHALSPYTRFKFETKSLHQFYQSKMDFHINDHKLD
HHLISNGKLWALDDLYIGPSCPDHCNGHGECLFGECNCDAGFQGESCRYITPPPMKMNLN
FSTVTNFDSHWQELLGGKIVTAGEGCGVVLAGESLYFYGSLLRRATTRDLCGPSVDFIQF
YLKIGGSNNSNCLSQKFKPRLNTENNAKCYERDLQKRGDNKNLLLSYTRNGGATWDLLKE
FWVDHFRAARFVHIALPPEAQTGPVQFRFWQPVKYYDYIMDDDDDDDYETRINEKENSYD
DVYYDEYDENETGGWNYGDVSDENHDLMYEIDEQWAIDDLIIDSYETSKTKRSTKVTANA
NGLSLKEFSSIDGDGWMTLTDSMIGYYCSSAHPVIMFNLDFSEKIAMTTELIVQPGDVLQ
FKINVGCSQSFNPNHPVYLEYSINRGMTWHLVKPPCYQAPGYDDAACTKSELMDASVYYE
GGRVGWVTEVVPLDHLMSTSIRTFNFRWLQSNNSRIIKLDKNSYSADRIKSNDTNNYNNN
NNNNNYPFTFALSDVYVGPACYKHCFGQGLCSVDGCLCFKDFKGKFCEHFRLTDVRWIDK
FDATTSPTNNKTFTYARHKINSKVDNQGTSKSKLSKYWSEVLGASVGLAACYAATGDSGL
RSEALNFNNYGTRMARTFPLDVTHKKSIQFLIQIGLTLNVKDCKPPRSYDDRVIFDYSTN
NGITWTTMKQLDPHALANRPQTLSFNLARNSKSNRTVFRWWQLLGDPPGNLERAGWSIDD
VVLIDDVVITDLMEEDGGNEESYQGDEATHKRAFADDANFNTYLNGNNFNSSRKTQLHHK
QHFGFLNDFKGGINYEIWSNLIGGFIGIYCKSGHDVLVFSKNSERRYIETWDFPVSKMTF
IQFELVMLCGDFHSTIFNISLDFSVDQGRTWYPVVPSCYATDVYHCTAQQLDGTFNSAMY
KNWKRVTIPVPTQAVLDY
Download sequence
Identical sequences T1ESF3
XP_009022762.1.102002 jgi|Helro1|162255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]