SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163136 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163136
Domain Number 1 Region: 134-250
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000314
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 21-167
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000022
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163136
Sequence length 254
Sequence
MYHCSDGNNLDLGLTCASRSCKAGWTGDACDKRDCQTNNGDCGIHACTTFQIKTKIFSEC
NCKDGYRKQYFNDYCTLVPDVCTSYRNICNTTISTCNQTTPDSYFCLCMAGYKNPPTDKT
ICIDVDECAEMLHNCNSTVESCLNTLGSFTCQCVSGYRRINDTCIDIDECLNATNPCDPD
KSTCINQIGSYSCSCFKGFYNKNQWLCEDVNECLKDATICNTAVSTCVNNIGTYSCSCNG
GYANRDQWNCDGNR
Download sequence
Identical sequences T1ETP7
XP_009025348.1.102002 jgi|Helro1|163136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]