SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163140 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163140
Domain Number 1 Region: 197-348
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000157
Family Fucose binding lectin 0.029
Further Details:      
 
Domain Number 2 Region: 26-193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000547
Family Fucose binding lectin 0.014
Further Details:      
 
Domain Number 3 Region: 661-702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000935
Family EGF-type module 0.0087
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163140
Domain Number - Region: 564-702
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000361
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163140
Sequence length 715
Sequence
MTPMKKLYEQEPPWFLSGCYSLATVYVNVALKKPAVLSSTSQSYFARYGVDGDKTSLTNF
ARSDGATFSYSGWFVVDLVNAYQAKFVTVFNRVDGAVCVGSCHNRMNYFIVGLTNYFDAT
VNSTATIRGNYDLCGQWPVEVTTASQVMSVNCVDQEKFYRFVIIQQSLQYEQSLASGNTN
DKAVQLLELEVYTNENFLQYENVALKKPAYMSTPFSSNIAYNCVDGIKGSSNFCKLGTET
APVKNWFIVDLTRNYQVLYAVLYTVDQSMEGFIVGLSNTVNQNSPGAIRGTYDNCTTGPI
TYSDSAQPLRVDCNYGSNTYRYVIVQQSTTKATSANTMTFSELEVYGSENTVYKYVGCFR
TFQKQATFHESSLDICITLCKELNYPYATIRERHWCFCAAVTPTDLYPSSSCFSYCNSVT
GICDETDLNAVYSTQPTPGYMGCYQDVGANADKDLNLKSENLPGMTIETCITYCLVNGFS
YAGVQSSTFCYCGDSYGKHGKVLDNVCNSACGGLPLTEYCGGPSSNNIYSLCNKLGTRQS
CSQVHHCTTPNSLTPDMTCNPSSCLPGWYGPACDLRNCNVNNGDCGIHPCSSFQIGSTVM
TECVCRIGYMKYFYNDYCQLVNSVCNVFPNLCNNTISSCIVGNGDYECNCKTGYQHPTNP
INNTVCIDIDECATSNPCDLTTQYCLNTIGSYQCLCRPGFLIGDCSADLEDLCPF
Download sequence
Identical sequences T1ETP9
jgi|Helro1|163140 XP_009025351.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]