SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163146 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163146
Domain Number 1 Region: 22-162
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000000000284
Family Fucose binding lectin 0.013
Further Details:      
 
Domain Number 2 Region: 371-491
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000942
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163146
Domain Number - Region: 317-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0147
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163146
Sequence length 529
Sequence
MKHIITSVCLILLLMLCVYGQNTNLALRKPIYASSVYSNEYRPEEAVDGIKKEYGNMANT
ADGSAGWFVIDLQKKYRVLYVTMYPRERVNGFSVGLTNNFNSATNVSLIKNELCATSTKQ
FQKPDLETLYCKKPYLRSRYVMLQQAVTSGEFNVEELEVYGSEIYDDNHLGCYSNIEGTH
KLDVAAVEQCSTQCTAYQFFVIKNGKECSCLSYTSLPSPLISSPLSNCNLTCSDDGYMCG
GFSYYSLYSVKDCALNAAPASSSPSPTTLPPQLDLLSSGQCIITTHCSAGATAGSDVCPS
QSCVTGWNGDVCDDRDCSVNSGSCGVHTCVSVTTGGTNTMSECQCKEGYYKTTYREDCKD
LNECMYPSLNKCDNATTSCSNTAGSYECACLSGYEKKSDIYSCQDIDECKSSSLNKCNTT
STFCENTVGSYKCTCIEGFQQILNNNYSCNDIDECLTTCKQEFESCVNTGGSHSCECISG
YERDNKDTCIAAPNKAAIIGGVVGGFFGLLLIIGVIVGVIFCLRKRRKE
Download sequence
Identical sequences T1ETQ4
jgi|Helro1|163146 XP_009025357.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]