SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163149 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163149
Domain Number 1 Region: 562-848
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-56
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000773
Further Details:      
 
Domain Number 2 Region: 411-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000093
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163149
Domain Number - Region: 17-56
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.00733
Family Periplasmic chaperone C-domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163149
Sequence length 1130
Sequence
MCIGMISSEQVLDGESKRLKQKIAKDQTAIVNSTPNHVSIHQIELHYNDLTAAGVESEYK
CFTRPQSFVLCEMNDSLTGDEFYENLLLDGSTIVLIDSPNMNKVLKATLLPEPKQSKTFK
NFSLENTSQPADGEDDYSAPVRMPCTSLKLTNKSTTYENKSEQAVYENVALSCREVKLFT
VSSLDQVAFLYEVLRETIGNPTTSPIPILFRMTKFSVGLLLDYAVGSSPIVNNGCGAYSP
CSNFGDVCRLNCSQPFQKSRYVVLFSNAKDNIANVAEFQIYGDDTSSYSDRYMGCFQKFL
STSNQGSVILLYQCLGRCSGNLYAGVMNGKDCYCSNTLIGDLASSDHCGVACSSDDHLCG
ATGYFAVYNDCSVNNGMCVVHTCKTNLIGPSSISECVCNVGYYKNFYSDDCREVNKCSLN
ANLCPVNISTCVNTPGSYICNCTDGYVRSGQNNCTVILNLKVNQAVLKEGMLNNSSSNTS
AIIGGVVGASVALLLIVGIFVAAYFCKRKKNQQRTSNSNIGQIISRKPTIKLALEKVQKN
VDGSSSKVPIGKLENYYKSLTLQGVFDQFRSVPVRNNHSSSYAEKPELNKKNKSKEIVPF
DENRVKLKTLDDQPFSDYINASIVPVHINNFQWKNNRNFYQILFFQSYRSKKYSFIATES
PNRETMNDYWRMICEKDVQIIIILNLRGQKSKDILKSFLPDLDEKLQFKNNISVKCVSLE
KWPTYEIRKFYIKMKSQEFMPTCMGYTGWPDGGLSNNVGCFLNFHHRMKSVLETKKNFDK
NHSNIVVQCETGVGTSGIFIGLNYLIEQCEDKSMVDVLQCLRYLRSHRNHMIQTEEEYDF
LYKSMIAYHNLGHTTCFSINEDSFTKFLSSETFNKSLEIQFRCFNKSNAFLTCEIGKNLK
GSVLYDDVLAGGSIIVVIDSKPTKQSALQLLIPDSGRKLTFHKMTVENNDETNRIYETAN
CINNPSTITLTLTMNDDKVKEDEIYEDDNVYNKLSNHGRSIKIHSLESINQIQSLYNLLK
DSIKNPKSPAIPLIYKNSEDSDVNAVLVMLSVLEMMDSNEQVDVYQAVRQLQPLRNSNHS
SHKNINYYNINTDDDVTDDVYSYNNDDVFVTMKQYRLIHEVVGNIVGSRK
Download sequence
Identical sequences T1ETQ5
XP_009025358.1.102002 jgi|Helro1|163149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]