SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163239 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163239
Domain Number 1 Region: 139-205
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000011
Family Ovomucoid domain III-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163239
Sequence length 297
Sequence
MKSFLVYAQILFQLFLICSLRDSSAGKSKKTATPTATVEPILVTSTPRNFSSNRPDFVPV
NKNKYQNYVVTRVSQSDDKILTLKPSTKSKSRRKSHKNPDKLLSPVNNTNFVSTSYPPVL
AMSPSLTTAAQKNPCADIKCSKFEECYINMQRLPICKCPNVYMCSILPKEYVCSVDGNSF
KNICLLKIKECQENRNIKVAHRGKCSWRERMKSRREVEQNKQRTSERKNRKHTKNNKNLE
IDQWKINKNNKKLQSLGKKHNKKKHPKSQNRNKTNTFVNRNDSKVRKEKNHTTRRSN
Download sequence
Identical sequences T1ETT8
XP_009025417.1.102002 jgi|Helro1|163239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]