SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163426 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163426
Domain Number 1 Region: 16-80
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000432
Family Spermadhesin, CUB domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163426
Sequence length 156
Sequence
MAYHLSSHIRIFVRCNEKTQSDYVELSNFNVQLMDRKMSRLCHKLPENRRVIISDNNFFR
VTFKSNDRFDSTGFLATYEFKKIEGGVVLRRLLTYSITTSFPAGGGGGDERDDDRDDDGV
DGKSAKKHANLAFGGKQTGSLLLFYAISSSFFIHYF
Download sequence
Identical sequences T1EU11
XP_009025541.1.102002 jgi|Helro1|163426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]