SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163463 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163463
Domain Number 1 Region: 27-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.2e-18
Family Fucose binding lectin 0.039
Further Details:      
 
Domain Number 2 Region: 341-386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.012
Further Details:      
 
Domain Number 3 Region: 464-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000213
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163463
Domain Number - Region: 297-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163463
Sequence length 565
Sequence
MNLIVLSHFVLFLVILNNIPMSVSVLFTNLALKKNAYLSREHPSYPASYATDGITDDDSN
IAGTQSNGEPGWLVVDLGLRFNVINVSVQMGINCCWSQMARFEVWLSNSFDPIMNVTITK
STKCGVYSGLVFPNSLAFLNCSKSNNHRYVILHQADGNFGLGVREFQIFGYEDFVDYFIG
CYVGFNESIPTVQVYTPFQCFNVCQQRGYKYLAFKKKVCHCSNVITSAISISFLCEQSCV
PEERLMSCPSAERFQVFRVNQCIPSDTKENSYDDCKTHCLGGLPLNSYDRCESCELGWDV
CESSNGHCADDMCIAYSDTRYYVAECECRSGYDRMSYNEDCKEVDECLISTHKCSLDSTY
CINTIGSYQCRCKEGFQATNSRFYCHGDRTYQICTIVFASLLGLTLLIFIISVLIFKCKQ
SNSMERYDNKGQPMRNNNHEMHAFPGASNSNRDHENDGYQHLTNKHYCDLESTACMNTIG
AYHCQCKNGFKPSASAFCCYDKDARKNDRANNNDRNQIMNHGSSNTDGNLGMYTIPNSRN
HPNDVHLYEKASNHLHNNSDESFSN
Download sequence
Identical sequences T1EU31
jgi|Helro1|163463 XP_009025571.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]