SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163770 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163770
Domain Number 1 Region: 280-396
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.3e-23
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0019
Further Details:      
 
Domain Number 2 Region: 217-261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000984
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163770
Domain Number - Region: 384-421
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0149
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 
Domain Number - Region: 7-118
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0638
Family Fucose binding lectin 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163770
Sequence length 578
Sequence
MRNLAINADRSNWMVFDLGEFCRVEYVVLYNVVQSADGYLYGSADRMEKFSVGLLLDYVV
GSLPTDNKKCGTHPSCSNVGDVCRLNCSQPFQKSKYVLLFSNAKDYTVNVAEFQICGDNI
SIDNRTTVKITRRHDQLPGDLTSSDHCGVACPSDDHLCGAPVSNCTKTSDSIECNGRNCS
VNNGMCGAHTCKTNLVGPSDISEYVCNVGYDKNFYSGDCIDINECSLNANLCPLNISTCV
NTAGSYVCSCTDGYVKSGQNSCTALLKNINKKKFFFKEFSEIYCHLQWYTDWPDVGLPNN
VGSLLNFHHHMKSFLETKNNFDKNLSNIVVLCETGVGASRIFIGLNYLIERCEDKSVVEV
LQCVKNLRSHRNHVVQTEEEYDFLYQSMIFYHNLGHTCFSISDDSFTKFLNSETFIKCFN
KSNAFLACEIGKNIKGSVLYGDVLGDGSIIVFIDSKPTKQNALQLLIPDSGKKLTFHKIT
IENNGETNHVYKTANCINSPSTVALTLTKNDDEINEDDIYKNDNVYNKLSNHGRSIKIHS
LESIDQIQSLYNLLKDSIKNQKCPAIPLLYKYVFMCRI
Download sequence
Identical sequences T1EUG1
XP_009025797.1.102002 jgi|Helro1|163770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]