SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163831 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|163831
Domain Number 1 Region: 47-152
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000785
Family Spermadhesin, CUB domain 0.0059
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|163831
Domain Number - Region: 294-351
Classification Level Classification E-value
Superfamily ARM repeat 0.000518
Family GUN4-associated domain 0.076
Further Details:      
 
Domain Number - Region: 464-492
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00131
Family Spermadhesin, CUB domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163831
Sequence length 525
Sequence
MSTQSPFDPGCECLLFENNNNMNTISTGSIDPNNDNDDDDNGSNNNDNLFTSILYPLSYP
VGIACILYTFVGEQHELIEISFVYFNLRKPVNGKCVDYVRLHLDLERPEIIEGGGAVVVE
LCGSQEEAISAGAATYYSSKRTMVLEFHSDPRDDESEVGEMKRNNNGTLTSPKYLTAGEA
HVGGSPRETSTHRHHLLQQHEQWSLPNDDHQQQHNQQRKQQQQQKQQQQQQQHLSKQPQR
QQTDQRHQQPQPKLQQRKLKPRKQQQNGNSFVQTSTPPYQQNNNQQQNFSKTKILKKKIS
AGNLRKARNNDEEEDEDDDEEGANDDDEEDDDEEDEDDDDEEADVEKENDEKIQLQKGSK
HDNIHSYDTNNKQLNRNNSIVGNKNNSNSNKTETNGHQRDGMLQGSNGCFGFLAKYRFID
KNEPYFDFSQIIFDAEEFEWTGAIRRYGSECDADFHSNRNLKKGQFFSPLYPRSYRQGVS
CRYLFRGAPGELFLKFCLRSSTYFRCLCLFVFGRACVSSFEVYAP
Download sequence
Identical sequences T1EUI7
XP_009025845.1.102002 jgi|Helro1|163831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]