SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|163999 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|163999
Domain Number - Region: 149-186
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.014
Family Cytochrome c3-like 0.045
Further Details:      
 
Domain Number - Region: 48-92
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0209
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|163999
Sequence length 236
Sequence
MKSFKKFTGIKFEILNDPRRQCFSTSTSSLPQPSSSSSSSSSSSHSGDLSGYISSLVPME
TGCGTKDVHWIISGQPGQQVNISIIDFTSSFNFRLAASSESDYNSIINNANINDINNNIE
NNINNNINNNININNNINSINVISIDTQHKKFIDYETEECFTWHGHHRQDGLALNKCVSC
HFMKPRLLFKIVIIFVNHSAESFASCSRVLATPPQPQHNIPAHPPLGIRHSLNSSG
Download sequence
Identical sequences T1EUQ8
XP_009027312.1.102002 jgi|Helro1|163999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]