SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164165 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164165
Domain Number 1 Region: 185-279
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-22
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 2 Region: 43-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-21
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 3 Region: 322-440
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000068
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 4 Region: 458-511
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000942
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164165
Sequence length 581
Sequence
MDELSWCVGVPGLGFFQPGILNLLNIFLEDCDVTVNSSLSITSSKNGTISSPNFPFPYFP
NLRCIYRFIGLPTERVRIEFKEFEVKGVPPSCLQDYIDIYTQVEKPFQDLLDIPLHGRFC
GSGLDLLPNILISMHNALIIGFYTDHIKEEKGFLAEYSFIDDSLYLVGTPAPFNQCGQTI
YGTSKPSGFIYSPTYPGVYPDNVFCFYHLAGIQRQRIKLTFLEIDLYSGGDHCPYDYILI
YDGPTNNSEIINTFCGHRNNVTLFSSSSNLYIEFSTKSGRLESTKRTYLHPWESSKSDDV
IVQRRGFKAFYEISGAFVDLECDQMVLSTKESNGVIKSPNFPYNFPLKIRCNYYIDGLED
KQNLEKAKIEFDYLNIPKVRDGCNNGHLKVYLKGQIDKPDDILCGTTTPSPLTSSNPRLL
LTFDTIDANYAGKGFKAKIQFLTDFAIPGTPATDGLKCHFIYKSTSSNQGAFNSPRHPSN
YPDDSACIYEFISAKAEQIRITFETFKLENDTKWVLKSALNFASDGEVVREVGREFQRKG
PEKAKADLAKECLTRVTSAREQGMEIYEKRKGHEQLDEQQS
Download sequence
Identical sequences T1EV11
jgi|Helro1|164165 XP_009027425.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]