SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164375 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164375
Domain Number 1 Region: 269-287,417-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-31
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 45-82
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000222
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 3 Region: 111-155
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000388
Family Ovomucoid domain III-like 0.0091
Further Details:      
 
Domain Number 4 Region: 303-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164375
Sequence length 599
Sequence
MCNGVQCLYGSSCVDGICSCPENCPLDADDYNRLRIFEDEEDMEEAVCGTDGVLYKSECH
LKLTACKQALPIYVHHYGDCDEGLPWLDSCETKTCLYGGTCEVMEENGKRIEKCICSLDC
SDVRYEICGSDGNLYMNECYMRRSACRKQQDIYQIDPLYCEGVEEKHCDGFEIVRDGMTD
EELLCRNDAPYEKCPADAYCHVIDQIGKCCHGYQVLSGCETSEHGCCPDRSTSALGPQYF
GCDLESIDVCHCNPVGSTSTECDAATNSCSCKQNVGGLKCDRCHSGFWGFPLIAEGQPGC
HACNCNALGSFRSDCDQMTGRCLCKGHAMGDKCQYCLNGSWLTEQGCVAATTFETTLRSV
DISTKKTTPEPSKKTTKAIVDANKKPKTTKSSKKMTTTSVVKTTTRKTSSSSYISPHFNG
DSLIRLRNLVHGKHDVTINMKFLPLSLDGLLLYAGHLDKLKSGFLSIALKNGSVEFRFDL
GSGPATLRSDETIKLNQLHTLSATRYGKDGLLKVDGGSNVVGVSRGSSRTLEMDVPLFLG
KIPHSDIVSKKNNHVDVGYVGCIESLNISSSLQNTAEYNLSKDPSFINTDIIMERKICS
Download sequence
Identical sequences T1EVC3
XP_009027574.1.102002 jgi|Helro1|164375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]