SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164376 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164376
Domain Number 1 Region: 166-231
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000222
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 2 Region: 291-331
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000018
Family Ovomucoid domain III-like 0.0069
Further Details:      
 
Domain Number 3 Region: 40-162
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000294
Family The laminin-binding domain of agrin 0.0019
Further Details:      
 
Domain Number 4 Region: 336-369
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000139
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164376
Sequence length 403
Sequence
MTLLFVILLLNNVLLSYSIKKNLLSYELSRRQSEECFDLTIEEKVNNAEFIFSGTVREVR
YNVDKKAQKASVEIKRIFKGQHKLTQLFLSEIKGRFLPIVHKVCTVEGLGLDGLCSSHTR
VFDTWLFFTNPVDDKLQLNSSLVRLSVMSIASIESAVADSDECSDDHFCQYSEKCVRSAE
GKFECRCLQECSLVGEAVCGSDGVTYVNECFLNRTMCHAKKHIYVHNFGPCVCNFYFWQA
ETRDPCATITCYYGSKCAVEENQPSCVCEDDRSCEAYDENEDINDVQSHYHKHEYNSVCG
DDGVQYRNICELRKRQCIEQREINVKVYGLCGGRELCGSGGNMVRNECEMRWSACSKQED
VYHVHESYCELEETKKINSTPVSHVTEKTLKTPAFDGETFWGI
Download sequence
Identical sequences T1EVC4
XP_009027575.1.102002 jgi|Helro1|164376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]