SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164538 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|164538
Domain Number - Region: 111-208
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00863
Family Growth factor receptor domain 0.0091
Further Details:      
 
Domain Number - Region: 153-182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164538
Sequence length 219
Sequence
MCACVVILGGKCKAERSSTISFLPQLSPPSTSPSSSSTSPSSSSASLSSSSSSSSPSSTA
STSTPPSTDQLLYAHRTVRTDLNASLMWMTYADDDITFHVRAICSAKLKGPICSECQPTD
NSESGHYRCQEVTEDMECLPGWSDPDNLCRTPICDPACVSGECISPNECSCLPGWKGERC
ETCVPTLPCHPVNGYCTHPGECLCKPGWGNGIIGCDLGL
Download sequence
Identical sequences T1EVK0
XP_009027698.1.102002 jgi|Helro1|164538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]