SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164641 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164641
Domain Number 1 Region: 258-358
Classification Level Classification E-value
Superfamily TNF-like 1.3e-17
Family TNF-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164641
Sequence length 361
Sequence
MTRQKCKKKSNNNNNNKNNNNNNNNKDDEADDGVARKFQELQLQIDQLKSQLNDYKDEVT
HLKAFIINSQDDDEDDDDNNNNNNNNNNNNNNNNNNNNNNIFDKTASKYSNHIGDDDDDD
DDDYDGVYDDDDDVINDDDVKSRDVRGYEFILSAGRKKRDVENVRSDERSSENRSRDNHR
STSIAPPSSYSLDGDDYANNPISSSSSSCKNLAAIHLEISESGRRRRNLSTEQSTTLSNW
EVPSQGFASENTADHFKFNRDGETKELVVKKRGVYFVYGQIMFYNLADRNIFSIYIGGRE
FIRCVQGVDYEIGQKKYKTCYTAGVVYIGEGEKVSLQNLYNYEIDAKKTSNFFGLIKLSD
F
Download sequence
Identical sequences T1EVN8
XP_009028903.1.102002 jgi|Helro1|164641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]