SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164684 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164684
Domain Number 1 Region: 387-444
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000471
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 554-609
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000209
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 499-554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000432
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 608-664
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000523
Family TSP-1 type 1 repeat 0.00027
Further Details:      
 
Domain Number 5 Region: 443-499
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 6 Region: 717-777
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000327
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 7 Region: 278-387
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000183
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0046
Further Details:      
 
Domain Number 8 Region: 156-213
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000484
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 9 Region: 51-109
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000000981
Family Anti-platelet protein 0.057
Further Details:      
 
Domain Number 10 Region: 663-718
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0005
Further Details:      
 
Domain Number 11 Region: 116-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family EGF-type module 0.02
Further Details:      
 
Domain Number 12 Region: 213-261
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000536
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164684
Sequence length 987
Sequence
MSKNHLFVVTVLTLLTSKAQSQQRISQYFEWTESQITYQSSGYEFKGQTLASMNYSLVTQ
CAMACLKDPRCLSYNFNNVNNLCHLNSGSHQSNPELLKPSDGWDYYLKDAYKISQDADPC
LSTPCMNFGTCLSRSDKTYLCFCSSQWTGPVCNIKVDISWSGWSAWSDCSEKCGPGVAAR
SRTCVNKVDMSQKSVEMCYGMSHEIEECKVKDCPYWSEWSEWSQCSTAESCGEGHSSRIR
QCVNSDPDQNCFGLAAENKTCSSVSCNAEVVLKPETGFPYGEGSLQIFENKQSDWLFVCA
DVIGGSSSSSSGDFAWTQQNGDVACKQMGFKHGAYSASKVLIDLANKDSEMYLLTNFKCS
GDEMTLTSCRHSGWSVSSCNQKLTVKCVVDGRWSNWSEWSKCSVTCADGAQTRSRACSSP
PPRNGGDGCEGRGQDTQPCSLPPCPVDAQWTQWTDWSGCTLTCGGGRQSRNRTCVPGRNN
GKDCSGENFQNKTCNTLECPIDGFWSDWSQWGSCNITCGGGQQIRTRVCEDPKYGGQPCS
GANITVQRCNSQSCAVDGYWLEWNQWSSCNATCGGGQRIRKRFCIEPQFGGLYCQGNNSE
FDTCNTDPCPIDGTWKEWRDWSSCSITCGGGRQIRTRECNPPKYGGLDCPGDNTMEKFCN
DEPCPVDGQWGEWTRWICSVTCGSGEAIRKRDCTAPANGGSSCKGLLEERDQCNMSVCPT
PAEWSPWSAWSRCSATCGFGNRKRTRTCTQTLSGLNSLPCLNETASNDTKPCNQFACSSV
QSCQDVAKLGLEESSFVSLSLNAAQPTKTTIVFCSLDGTTVSSIINSSYESDSMVTFKLN
APPPNYKVVYSSNEVQLSLDDVKTIVYNSKECKQQVSWKCKGYPMNIPSGGKLVYWKNKF
SDEMSYWGDISTVVGTATSNTILCSCGEKSTCLPYKCSCDKNDTLNWGQDGGWLTSKLDL
PLTEIVVLDSGYKLQEGKFRVGPLICN
Download sequence
Identical sequences T1EVQ0
XP_009028932.1.102002 jgi|Helro1|164684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]