SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164744 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164744
Domain Number 1 Region: 110-192
Classification Level Classification E-value
Superfamily Kelch motif 0.000000929
Family Kelch motif 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164744
Sequence length 254
Sequence
MIMRRRNTLQFHLKSGRRYEVARDSLLQNSSYYQDMVNSRMRDAHFKELTLDCLSDASLQ
EVSEFLLSLQSSEEDRSTKMKRIENIEKAYLNDSSYARIFGLAKKYALIEWFEKAPKLTA
RQDHVMTALGDKIFVVGGNCFATENGLDTVESAMRCLFIYPACGQWTFVLTLKLSFWTAQ
HSILFNGSLLCFALDWLNHNYVIQKINLKNYLDINISSSNELKKKYDISNATDTEESCGV
EHAVVYAVYPVVFS
Download sequence
Identical sequences T1EVR7
jgi|Helro1|164744 XP_009028973.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]