SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164756 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164756
Domain Number 1 Region: 305-534
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-47
Family Kelch motif 0.00052
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|164756
Domain Number - Region: 27-123
Classification Level Classification E-value
Superfamily POZ domain 0.0021
Family BTB/POZ domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164756
Sequence length 589
Sequence
MDRNNEKQIESANDVDDSKRVVLTSKVGGERFEVDKDLLLQTSEYYKALVNSGMRDAHCK
ELTLGLLSDESLTEIREFLSIFQVDDKNTKWKSRKMWEEGLKGASYLQISSMSHMYNDFM
SRYLKISTFARIFKFATIYMLHDTFRKVLDFISENFRKLQLRSEMLKLAPDDICYLLESD
YFNAESEFDIFNFIIRWISTDESRRQHAEKLLTRVRYGLMTTGERQRSNEILDELELSIY
KNEDVVENFRSVGTIFALGSSANKNIHYQEFQSISVHDFLKLTENENKTGSSTLQFQKSG
RLGPPLLWSSYKTCMLDNCLYVAGGVRHYSLITEEVWVYKPVTAIWTKVRNMYIARKEFY
FGEMGGLLYAVGGRTPILLTPFSEIYNPRYNKWVLTALQPIEFYRLAGCACNGLLYLSGG
LTESGSSDLVWRYNPGLNNWTEMARMLTKRSDHIMACIDNKIFVIGGSICDLEFFNCSDV
MSGEMYDCEANQWTKLLTLKMPVFDNVFLTIDNCIYIIGEELNSDNDSSSFFVQKINLRK
YLEKITRSRHDDSNTNDAAINNHDDGCQIFSCNNRLSYYYFFGIMKRST
Download sequence
Identical sequences T1EVS0
jgi|Helro1|164756 XP_009028981.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]