SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164766 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|164766
Domain Number - Region: 100-163
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.017
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164766
Sequence length 479
Sequence
MLFFFHSPPSLSSSTSFVSSSSLHSDIDSGLNFPQYIGDDNHHKKTPSPSSFHTPPSSPS
PASPSQHKFVLHLELNSAQVRLSIDAGTRENHNPHRPNYHNHPHLHHHHQNPHHHHHHHR
QQLKIGVKTSFDLDIWHKVGVTWFDKYVTLSVDDAKHVERVNDELLGILNDIITNSNDNN
NNNNKSNNNTKNNNKSNEYNGAKDESETTERFESKNTFVSSSSSSGSTGSSSSGGDSSSS
SSRSDDSDSNDSNSFSRSSGGGGSSNKKRNLVSRNPLFDSKLRLVLDRSTSASSRSSISS
SSGGNGSGSTSSSSSSGISSSGGKGSGSSSSSGGGSSNEAISINASEKSNGDIILSGRSD
DSIDKRTLHARSSKNTTTSIGGSGSGSGSSSSSSSSSRDDVSGSNVDTFIVTESSIKNRE
SKITASSSDGSGGGSNSGIVGDLYIGGVPLKVQHMFKKSQQVFSSHDSHLPNVIIIKRL
Download sequence
Identical sequences T1EVS5
XP_009028988.1.102002 jgi|Helro1|164766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]