SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164779 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|164779
Domain Number 1 Region: 297-537
Classification Level Classification E-value
Superfamily Kelch motif 2.22e-44
Family Kelch motif 0.00094
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|164779
Domain Number - Region: 16-109
Classification Level Classification E-value
Superfamily POZ domain 0.0275
Family BTB/POZ domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164779
Sequence length 612
Sequence
MECCYVSKTLVLVSGTGGRFKVDRDLFHRISDYYQARVKSGMKDAHHTELTLDLLSDRCL
AEVEEFMLKMQCNNKEIEEQSLENLEEAMHGALYLQVGDMIHQYISLLEKHITDSTWIRV
LNIAKKCGADTLIAKFLDFVCENFTRFVQTSDMLTLSPNDLLHLLKSDLLDADSEIDVFK
FVIKWISMEESRRPLAEKLLAEVRFSLMTTGEKQECSAMLSEMNLSHCQHERIAKARDTT
EVMLIFKGLHGKIDGFHFRPIEHLEASERDTTWRDYPMDDVVVEVTSDKLDRYKAVDLPM
KWCDYEVCIADRCLYVAGGSEFSFRSILYQLTSKVYVFSFAQSLWKQCSSMHLPRKSFYF
CSMAEGLFAVSGKTKFNKLTSTVERYKPMVDEWQTVTPLPVAVCGPAGCVRKGRMYVSGG
HTSSGDVSDSVWQFDPTCNTWSSVTPLLRARFNHTMASAGDKLIVVGGANAVRTFSFDHL
MDGEMYDFEADQWSDFIKLEKPACSSPSILIGSSLYLFAGVMDLSGESLVQKINMSKYLN
EKSSDESVVMERKKTLNENFEKCTAMEEVEEKRTISPDRKDYCEVSSFRFDGGCFRNMCV
TKLPKKLFLQSL
Download sequence
Identical sequences T1EVT0
XP_009028997.1.102002 jgi|Helro1|164779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]