SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|164831 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|164831
Domain Number - Region: 29-89,128-158
Classification Level Classification E-value
Superfamily POZ domain 0.000753
Family Tetramerization domain of potassium channels 0.093
Further Details:      
 
Domain Number - Region: 317-363
Classification Level Classification E-value
Superfamily Kelch motif 0.0641
Family Kelch motif 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|164831
Sequence length 462
Sequence
MEEKSVETNQQFEMETDDAVDEPAKIALISSEGSRYEVAKDLLLQFSDYFQALTISGMRD
ANFKELTLECLSDASLREVNNFLLNLQSNEDHFGARDLCCVEKGLEGSFYLQIRSMTDKY
LNYLSGQLNESTYERILHFAKKFAMFGTIEKVFAFIFDNFRCIVSKSEILSLSPDEMIRL
VESDVVNVDREFDIFDLVVRWTSADESRRQYAELLFSKVRYNLMAVDEKRKASDLLIDLK
LKVQTECYGFCTIGTIIAFGEPTFKIIHQCHAIELPAGPLCIYRIATSRLPGWDPCTTYY
AQVYSLRLSLERVKQQGSGDKINKQDSEMFDCTTEQWTFLLSIKVPFNNPPSTVLINSSL
YSFHFDYNSYTSQNHLSIQTINLKKYLNDNKSSSNTLSDLATYEKLKTNDTDDEGINRKC
VCPVLMHPIFSYDTDTMLVHYYGSEFVKCPVTIAPLHVGQNK
Download sequence
Identical sequences T1EVV1
XP_009029037.1.102002 jgi|Helro1|164831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]