SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165051 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|165051
Domain Number - Region: 187-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000467
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 34-165
Classification Level Classification E-value
Superfamily YWTD domain 0.000916
Family YWTD domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165051
Sequence length 287
Sequence
MSIKQFFIEISCSNSDVLTAVLTKCEVDLHFHKNNNLISCDLSGKRCGNSLTKTEAFVNG
KGCITGITIDVKNGKISWMETENGKIFSGEIEHFYDDDQDNSSENVDGKIVWTEKIINTI
VISHSPNPSGLVYLRNHLIWISGDQQHAFIQDITKPDSVKTIPLDDKVKYTSIVTADKDV
HSTVHDSICTSEKPFCSDICVTSTKGERRCLCPQGHALRYGYLCMKEMANNLHYSALHLH
KFVTKVEPTPSNSTHMQVSPHPTQPTCKSDHIQLSPMHLNLINLKLI
Download sequence
Identical sequences T1EW74
jgi|Helro1|165051 XP_009029198.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]