SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165059 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|165059
Domain Number - Region: 73-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000435
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165059
Sequence length 211
Sequence
MYTEISRYKASGGYRGGRGSCLSFSRIKNQQLVFMQNKMYIEHNKNVSLGDKFKSVAIVT
ADRNIYKKAHESICTSLKPLCSDVCVTSSRGRRRCLCPHGFVLRYGYLCIKAICVSELVT
IHTNAHVDLAEFSHKTMRRVQGLFLLCCPKAYRPQILANFNVPLPKSDTVLREDIKTLKN
EISETFLNNVSKKLDLTKKQKPEYRTPIDKV
Download sequence
Identical sequences T1EW81
XP_009029206.1.102002 jgi|Helro1|165059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]