SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165066 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|165066
Domain Number 1 Region: 63-99
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000136
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|165066
Domain Number - Region: 15-47
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00502
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165066
Sequence length 268
Sequence
MVTADKLHLMKSHNSICTSLRPLCSDVCVVLGNGKHRCLCPQAFVLRYAKGTKKLGGKAS
FACYEYCLNEGICHLIDEISICFCNNGFVGDRCEQKSFYKHDENSFDSDFVFSSIFSNNE
TVKFNSTFSSDKIMMSGSTKKRSSSSLNTVIIIFVVMFMLTTVGFIFYRKGGSRSGIPYF
TSVGPEGAYINLVGAILSLTSGETVGYASSVSFSISWAQYLVLTLQTFEHGVPTVYENIR
VVFVPVGYGNILHKSVLTDSCLVLEHIS
Download sequence
Identical sequences T1EW87
XP_009029212.1.102002 jgi|Helro1|165066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]