SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165164 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|165164
Domain Number - Region: 89-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000122
Family EGF-type module 0.009
Further Details:      
 
Domain Number - Region: 463-517
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0659
Family Growth factor receptor domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165164
Sequence length 726
Sequence
MFANNIGANSFLFTGNNSNLITSNLSLLSGSFTTEKVSTTKNETKNEVIDQLKLRSSFVG
MKRGCLMEPDVCEAASSYCFGVKCHCKRDIDECSSNAAKCAKNVSKCVNTPGDYTCTCFP
EQDKLSDLKVIHPPSKKSTLKQKPSKIFNNKNKTTVNKGRSSNSSSGINSSSSGSNGGHR
VGMKHKINSKYKLTRSEFMTQRVLLPKDKRPIEPPRKIKTLYNMLEAAKQKVADEKAAEL
AVLFGVKKTASTRAAGATRTSHSSATNTSSGTVRSSIKNSSGKNRYTGQRSSDSFAVSGV
SSGSGGSNYVSSSPSDISLDDNSIKQTGYLASGSRVKRFNNLRRGKNNLKPENIAIGDVS
RSVSNISSDVKSRSTSIKVKSDQKALKTSDVRLLNVQSGKFNDGETKENNIGNKSVHKQE
SGKNYGKKQNNGGGYGVKGRSLQTSMKKVDSSDDHHHRCLLKPNKCNENSSICVLDGCQC
LAGFREVPGNLYACEDIDECADGESLCDTRFSTCLNIPVSPWSVRTVMGSVCLVISVLAL
FIILLIFGLRLKHDSEKSVYSKKFRLKKLREAKDRKEFLKIFKENSLLIYYQASLGYRSA
RKVEKELVEMVKIMEERNKTNLSRSDRYRDGRENVSRPNQTTKLKTDDYNIKEEEQIKSV
IWLLEKMKKINERNLKRKRRKKKRWSDSAGHDAGGGDGDAGNDDDVDDDESVVLLNEHEG
GRTNYR
Download sequence
Identical sequences T1EWD0
XP_009029276.1.102002 jgi|Helro1|165164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]