SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165236 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|165236
Domain Number 1 Region: 65-206
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000222
Family Pentapeptide repeats 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165236
Sequence length 264
Sequence
MSETNVDDVNVDEVNVDEVSVDEVNVDEVNVDEVNVDEVSVDEVNVDEVNVDEVSVDEVS
VDEVNVDEVSVDEVNVDEVNVDEVNVDEVSVDEVNVDEVNVDEVSVDEVNVDEVSVDEVN
VDEVNVDEVNVDEVSVDEVNVDEVNVDEVSVDEVNVDEVNVDEVSVDEVNVDEVNVDEVS
VDEVNVDEVNVDEVNVDDVNVDYIHINDICNVNHVSTPKNVTQKFCIAYDRRFKHKQKFS
KKYQGFEAGAGVRNNRSNDILVGA
Download sequence
Identical sequences T1EWH4
XP_009029333.1.102002 jgi|Helro1|165236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]