SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165341 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|165341
Domain Number 1 Region: 2-79
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000613
Family Laminin G-like module 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|165341
Domain Number - Region: 107-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000434
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165341
Sequence length 150
Sequence
MNSWYRVSVSKLQTVLMMKINNQLPYNKREPSTLQLINSIKTIYLGFPPYLSSRRKRIGL
GSGSIQGCIKSFSMNSSRLFVDYKLHDERGATDIKERHLIDVCKQSACSKFPCEHAGQCN
DINDGLSFRCVCKAGYSVLISAIQEFYSST
Download sequence
Identical sequences T1EWM1
XP_009030199.1.102002 jgi|Helro1|165341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]