SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165594 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Helro1|165594
Domain Number - Region: 712-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000206
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165594
Sequence length 761
Sequence
MGNLLSRKNFIAGMYFMHTKRTRKGEKGRRYTSRLNAPFNRITFLPITIIVCRDNNVNNN
NNTDNTNNNTNNNKIDNNYGDITKSNNINVNNNNLKNKNDMSVEINVISNSDISKNINEG
ISNINHNIIDKINTSSNSNNNNKSIQSGNLILLATEHFLLQHVHPRSRLIDMAEVEQNGS
DVSVVFPTSTDKSASDDDGAEIYIVKAETFATEIYHVGSYRAVKKSGVNGSRDFNMTSAI
AQQVSALMQDKHFTNNNNNNNTNNDDDDAINMNNNNIKSINNNINNNDNDIINISNSNNK
NISNTKNNNDNDYVTNNNNNNLQTNIKDDINYINKTSQPDILSYKNINSNATSDLNAGDN
NGVKINVNNNNNNNLNDNNNRDYNNLVNNNNNNNNNKVAINIREYIRRIFHSGYNNNNNI
NNINNNNKHNNNIVSDNLNNNIIIDNNADKNITNKNNNNNIIIISNNIINNKNGNNNISS
NNNNININITNSNYNDINRASINNTNNNDQMTISKNKLVKQSYIEADPTFIIHPVKQTHI
NSNNYTTNNTNNSNYTLDNNNNNINNNTVDIIVNNHQDINTDFAINTFYTYNHTNNSIDN
NMINNNIYNNNTDNNNTNITNNNINNNYSEIAGSGMHENKVVNKVAILDSLKLPPTLSPA
SSSTSSSSPLSSSSSSSSQLSSPSSSLPPLQQIVEENQLQSGPCDVACPEEDCSDWSVCR
NGGKCNDVTGYDSGAIVRKHWCKCQSGFQGTDCAKKVVAGY
Download sequence
Identical sequences T1EX19
XP_009030380.1.102002 jgi|Helro1|165594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]