SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|165611 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|165611
Domain Number 1 Region: 337-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.047
Further Details:      
 
Domain Number 2 Region: 935-983
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000198
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 1284-1326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 4 Region: 825-876
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000195
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 5 Region: 453-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000209
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 6 Region: 397-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|165611
Domain Number - Region: 509-552
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000159
Family Laminin-type module 0.011
Further Details:      
 
Domain Number - Region: 561-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000698
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number - Region: 1180-1220
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000725
Family Laminin-type module 0.079
Further Details:      
 
Domain Number - Region: 985-1023
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000949
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 874-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Laminin-type module 0.0079
Further Details:      
 
Domain Number - Region: 1218-1256
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0558
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|165611
Sequence length 1891
Sequence
MATDYNNTQQQQQQQHPNNYTINITTKTTHWLEEEQRKWIPQTKTVTANHWVPTHHRLTS
LHSPHHFITISLLLFFISPHLSIVVEAFENVCQAQTGPGPNDFTYSVCQGDPLKILRSNA
SYSNTSPRRCFTCTANQFPISYMTDVIPNTDGQPNYNTSWQSLTWLTFGRRPQASILISA
GRRFVLQDDLKFTFASQRPKQAILEKSVDYGVTWQTLQIYNISCASVYNAAIKQSIVAPD
DVMCSEEYSSEWPSTGGEVKFEVNRDRLQMYLGSMFNNFEALYNAYQDTNLLEFLTFTDL
KLNLIYPGTDGGEFSGRQNDLLGYSYAISNIYLVAGCDCNRHAKFCVPQNGRMVCVCEHN
TAGENCEKCLPLYNNRLWALGSFKPPLNGTANECQKCECHGRAVECLYDPGKGRGVCINC
ANNTMGDNCAECMNGYFINSSISIDDPGVCNKCDCEPHGMESSTEMNCSYGTGQCQCKKG
VTGLRCDSCYSGTYGLLSNDATIGTCKQCSCNVQWTINGRNDCDQLTGQCPCVTGVGTRD
CSICSDGYFKNATNNNKCDPCQCNYGGAVNQTCNKLTSDCTCRPNIISGSCRVAKPDFYV
PAPDYINLKPTPGSTSTCTNTTSVDKPIDEPFTERWYFSCFFGQKVNFVDVLSRVRRQGN
IIQSYVPSVRYAIRDVYSIPGATLTITNTGPNINFDPTLYPPSNGSASDCIQGSTQVFTI
FNLPPGFGQAWWNDTAKALLNARCKYDAEFKVTDAVNFSSPLLFDSLVLVPDPDASLVYT
SNVEKQEIYDQCIFGLIQMYSNVRNRCLEYYFTLMAEQTAEAYACNCDSVGTVPGSVCSY
VSGQCQCKLNVGGRRCEYCLRGTFAFSDTGCQNCSCDMNGSFHSVCDYTSGQCPCRPNVA
TYGQITTMGAPSERYCRFCLANFFGLPSGQGCQPCNCHSNGSASQQCDVITGACPCKDTF
GGQKCDQCRNGFYGFNATAGCTCDLSGNCYCKPNVGGAKCNQCKPGMYNLDATNADGCQP
CYCSSSASSPPPVCTSAVGFKMTTIQNDTGWEVQNPFFLFHLSSPPPYLGYRVSSYNQFI
QFTMLSNTTFNSGKVQLVILVAGDGRRISYQPDNVAFLQNQPNLLRVQLNEKFWVDSART
LSSLSQLLIQTYFLERYQVTLSQVIMTSSAPIDWPYIAINYVEQCTCSNNMEGLSCERCK
KGFKRAVVNDTTSACIDCQCEGMTADTQVCDEMVGRCLNCPAGRVGDRCDKCAPNVDESL
VGAEKCSKCKKGYWGISSAGCVPCQCNAVGSQDTTTCNMTSGQCTCQPNVAGVSCDRCSD
GYTNFTVAGCSMSSDQTSQINGISNATLFAFANRLVKAEADSKYLKTIVADLNTSLPSYS
DYIEELDVIYQIFDASLDTVLRVLSDAIAKLLDSIKTNQAHARTFANEASLKLLQLSKSF
PAYLLKTSQLSNLSDSLNQMNQQFSGVSSPISNSFAVLNNSVITLESNSNILNSNVINLS
TNLTQQIMTKNTSLVNDLNNTIEKEIASLNVSSASLKLGTAGIKLTAFNQLTFNSTVIYN
MIRNVNFTGDDVINVLALDDRFTALQNNALDLDTRVKTASNQTAPLENEIQNYTQLTTDL
LTRANVYLSQAATVNGRVTTASAKADQALNQSITVTNNAANMADVMKNFNDKANALIAQS
SGIIQTANNNINMITSASTTALAIITAVDPLLQQCTAAYGIANSTYDRCMSFNATLTPVM
TKSRNLTDSVNQNLNDVSFKMYQASRNALNSYSNDIDGYSTKASDLDNAAAKVRSLANAV
GNNITDTTKVLSNLNTRLDGINPPAIDMVTALLNDCRATKVTFDSYSLPAAVQKLQNDFL
LNKQWLDDLTKKRDDLLLQKNRMKVVMSQLS
Download sequence
Identical sequences T1EX28
jgi|Helro1|165611 XP_009030395.1.102002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]