SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166057 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|166057
Domain Number 1 Region: 221-435
Classification Level Classification E-value
Superfamily Kelch motif 4.45e-41
Family Kelch motif 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166057
Sequence length 485
Sequence
MVDDGKIHNIPTTEGHQIIISKSGGRHEFDRNVLCQESCYFQGLVSSGMRDAHYRELTLE
YLTNESLLEVNDYLSRKMSKSSEMLSILPDDMFRLVGSEDINANSEIDIFNLIIKWISAD
LLRKHYAEKLLHEVRFSLMTATEKKKCVSLLDDLNLNICHSKEKDANVFHTVGMLVAVGL
TASKDEKFFNMLHLFDLVDAFKSSAHPSKSSLLKFKFYGRKGPPVDLIECNARVVDNCLY
LVGGKTPNHENINDVFVYNPVLATWSKCCSMHLARSSFYLGEIAGHLYAVSGHIAFLFGT
PTVEKYIPSENQWYMVEPLPDALVCSAGCAFNGMMYVSGGFDEYGLVDLVWQFDPSYNKW
FSIAQCGHVMTCTGNNLFVVGGGTSEMSQWSINIMNGEMYDFENDQWSTVLKLKMFVHCS
PYITINNCIYIFQQKPLLDNMSDTHLQKINLTKYLGGKNTSDESNLSSVPDENANKNFWL
NEAEE
Download sequence
Identical sequences T1EXN4
XP_009031336.1.102002 jgi|Helro1|166057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]