SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166266 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|166266
Domain Number 1 Region: 104-239
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000111
Family SGL-like 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166266
Sequence length 291
Sequence
MEHVTLADFRDFTSHISRNKLSGCINQEIQNNWILVNRTTVYDATIRLTPNLQLYDFARE
FDFLCEENYGTDVIRIYHDYVSPNILSSLGDFSLEAEKLINVNTVHPLFVSPNSLCKNSE
EEIIIADTVINAIKIFDFFGNLIKIVDGYRYKKKLRAPDSTHPQDVCMDYNSQIIFLDLR
PKIVYIYNQIGVLLNAFYCPDVLYPCNIAVNKYQEIFICDNRKHCVETQIGQLEKSGEII
FEQIEQDVKEPASCPSHIRNIRDNDGSLKTGKRIFGATLFQCVCNIWGPDM
Download sequence
Identical sequences T1EXY6
XP_009031484.1.102002 jgi|Helro1|166266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]