SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Helro1|166269 from Helobdella robusta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Helro1|166269
Domain Number 1 Region: 257-513
Classification Level Classification E-value
Superfamily Kelch motif 5.49e-44
Family Kelch motif 0.00013
Further Details:      
 
Weak hits

Sequence:  jgi|Helro1|166269
Domain Number - Region: 25-123
Classification Level Classification E-value
Superfamily POZ domain 0.00424
Family BTB/POZ domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Helro1|166269
Sequence length 603
Sequence
MKKNTDDVVSKVGSTGERMILISKSGGRHPVDRNMLLRTSEYFQGLVNSGMRDARYRELT
LECLTNESLLAVRDYLSRLSTNEMESRGTSSLKSLNEVEAGLDGAFYLQINDMIDRYIEM
LLKHLNESTCIRILDIANKYLLIDQVVKKVIEYVLKNFKKISDSSKISLSPNEMFRLVAS
EEINADSEMDIFNLIIRWVLEDQTRKCFAEKLLTEVRYSLMTTSGRQKCTAILNYMNLNI
SCDADKDSNISRTVGTLFVVGSTKSKDDNIFNMLPVYNFVEACKASSNGTEPPVKFKTGK
QGPPPSLRGYNACVVDNLLYLVGGEPFTRNVSVYNPVTAVWSKCCSTHLARRNFYLGGLG
VNLYAVSGYTRYFKRTPTVEKYIPSENQWHMVEPLPVALTRLAGCVCNGTIYVSGGCDDR
RDVRNLVYKYVPSCNKWFSRAPMLTARCSHTMTCTEKKIFVFGGKKGSIENAMDGEMYDV
ESDQWSSVLKLKLPVCDSPSIAINNCLYIFQYEILSDYTWRTVTQNINLTKFLKKNNTSS
DSSSSSVQGRNANNNNLVTNEAKVQNSPDAPTNDDCQVFRYKHANSEMQFYCHYVGVMAM
SDI
Download sequence
Identical sequences T1EXY7
XP_009031487.1.102002 jgi|Helro1|166269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]